PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Han000973
Common Namekn1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Heliantheae alliance; Heliantheae; Helianthus
Family TALE
Protein Properties Length: 362aa    MW: 40097 Da    PI: 5.2485
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Han#S18764409PU_refUnigeneView CDS
PUT-169a-Helianthus_annuus-25558PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.72.3e-092903242155
                HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
   Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                k +yps++++  LA+++gL+++q+ +WF N+R ++
  Han000973 290 KWPYPSEAQKLALAESTGLDQKQINNWFINQRKRH 324
                569*****************************885 PP

2ELK41.13.7e-14244265122
        ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                ELK qLlrKYsgyLgsLkqEF+
  Han000973 244 ELKGQLLRKYSGYLGSLKQEFM 265
                9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012554.4E-2192136IPR005540KNOX1
PfamPF037903.5E-2394133IPR005540KNOX1
SMARTSM012568.8E-22156207IPR005541KNOX2
PfamPF037913.7E-21160205IPR005541KNOX2
PROSITE profilePS5121311.174244264IPR005539ELK domain
PfamPF037896.0E-11244265IPR005539ELK domain
SMARTSM011882.8E-8244265IPR005539ELK domain
PROSITE profilePS5007112.908264327IPR001356Homeobox domain
SuperFamilySSF466891.15E-19266341IPR009057Homeodomain-like
SMARTSM003896.0E-13266331IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.608.4E-28269329IPR009057Homeodomain-like
CDDcd000861.25E-12276328No hitNo description
PfamPF059205.1E-17284323IPR008422Homeobox KN domain
PROSITE patternPS000270302325IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MESDGDGGGT SSCLMSFGDT TNNINNNSSN NNNSNNNIGS LCLPPNPPGA YNTTTNNNNL  60
IFSDHHPSAM MLEDNNININ DGVGLAFMNP SSSVKAKIMS HPHYPRLLSA YLNCQKIGAP  120
PEVVERLEEA CRASVVAAMS SCSGGAGTSD GSGGGMNMII GQDPALDQFM EAYCEMLIKY  180
EQELSKPFKE AMLFLSRIES QFKAISISTS DSAGGEGGMD KNGSSEEEVD VNNNLIDPQA  240
EDRELKGQLL RKYSGYLGSL KQEFMKKRKK GKLPKEARQQ LLDWWTRHYK WPYPSEAQKL  300
ALAESTGLDQ KQINNWFINQ RKRHWKPSED MQFVVMDAAH PHYFMENMNI LGNPYPMDVS  360
LL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1259268LKQEFMKKRK
2265269KKRKK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002518420.11e-153PREDICTED: homeobox protein SBH1
SwissprotP466081e-140HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLQ8LPN10.0Q8LPN1_HELAN; Knotted-1-like protein 1
STRINGVIT_10s0116g00190.t011e-148(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-128KNOX/ELK homeobox transcription factor
Publications ? help Back to Top
  1. Tioni MF,Gonzalez DH,Chan RL
    Knotted1-like genes are strongly expressed in differentiated cell types in sunflower.
    J. Exp. Bot., 2003. 54(383): p. 681-90
    [PMID:12554711]